LOCUS AF055587 5990 bp DNA linear INV 16-JAN-1999 DEFINITION Plasmodium vivax cytochrome c oxidase subunit III (coxIII), cytochrome c oxidase subunit I (coxI), and apocytochrome b (cytb) genes, mitochondrial genes encoding mitochondrial proteins, complete cds. ACCESSION AF055587 VERSION AF055587.1 GI:3088633 KEYWORDS . SOURCE mitochondrion Plasmodium vivax (malaria parasite P. vivax) ORGANISM Plasmodium vivax Eukaryota; Alveolata; Apicomplexa; Haemosporida; Plasmodium. REFERENCE 1 (bases 1 to 5990) AUTHORS Vaidya,A.B., Akella,R. and Suplick,K. TITLE Sequences similar to genes for two mitochondrial proteins and portions of ribosomal RNA in tandemly arrayed 6-kilobase-pair DNA of a malarial parasite JOURNAL Mol. Biochem. Parasitol. 35 (2), 97-107 (1989) MEDLINE 89364999 PUBMED 2549417 REMARK Corrigendum. Mol. Biochem. Parasitol. 39,295-296 (1990) REFERENCE 2 (bases 1 to 5990) AUTHORS Suplick,K., Morrisey,J. and Vaidya,A.B. TITLE Complex transcription from the extrachromosomal DNA encoding mitochondrial functions of Plasmodium yoelii JOURNAL Mol. Cell. Biol. 10 (12), 6381-6388 (1990) MEDLINE 91061745 PUBMED 1701017 REFERENCE 3 (bases 1 to 5990) AUTHORS Vaidya,A.B., Lashgari,M.S., Pologe,L.G. and Morrisey,J. TITLE Structural features of Plasmodium cytochrome b that may underlie susceptibility to 8-aminoquinolines and hydroxynaphthoquinones JOURNAL Mol. Biochem. Parasitol. 58 (1), 33-42 (1993) MEDLINE 93211452 PUBMED 8459834 REFERENCE 4 (bases 1 to 5990) AUTHORS McIntosh,M.T., Srivastava,R. and Vaidya,A.B. TITLE Divergent evolutionary constraints on mitochondrial and nuclear genomes of malaria parasites JOURNAL Mol. Biochem. Parasitol. 95 (1), 69-80 (1998) MEDLINE 98434254 PUBMED 9763290 REFERENCE 5 (bases 1 to 5990) AUTHORS McIntosh,M.T., Morissey,J. and Vaidya,A.B. TITLE Trans-association of ribosomal RNA encoded by scrambled genes in the mitochondrial DNA of Plasmodium yoelii JOURNAL Unpublished REFERENCE 6 (bases 1 to 5990) AUTHORS McIntosh,M.T., Srivastava,R. and Vaidya,A.B. TITLE Direct Submission JOURNAL Submitted (24-MAR-1998) Microbiology & Immunology, Allegheny University of the Health Sciences, 2900 Queen Lane, Philadelphia, PA 19129, USA FEATURES Location/Qualifiers source 1..5990 /organism="Plasmodium vivax" /organelle="mitochondrion" /mol_type="genomic DNA" /strain="Salvador I" /db_xref="taxon:5855" misc_feature complement(321..499) /note="similar to prokaryotic large subunit ribosomal RNA; LS1" misc_feature complement(691..745) /note="similar to prokaryotic small subunit ribosomal RNA; SS4" misc_feature complement(749..828) /note="similar to prokaryotic small subunit ribosomal RNA; SS6" misc_feature complement(885..1073) /note="similar to prokaryotic large subunit ribosomal RNA; LS7" misc_feature complement(1077..1155) /note="similar to prokaryotic large subunit ribosomal RNA; LS6" misc_feature complement(1292..1363) /note="similar to prokaryotic small subunit ribosomal RNA; SS3" misc_feature complement(1387..1490) /note="similar to prokaryotic large subunit ribosomal RNA; LS3" misc_feature complement(1553..1649) /note="similar to prokaryotic large subunit ribosomal RNA; LS9" misc_feature complement(1653..1771) /note="similar to prokaryotic small subunit ribosomal RNA; SS2" misc_feature complement(1817..1851) /note="similar to prokaryotic large subunit ribosomal RNA; LS4" misc_feature complement(1858..1881) /note="similar to prokaryotic large subunit ribosomal RNA; LS5" gene complement(1998..>2747) /gene="coxIII" CDS complement(1998..>2747) /gene="coxIII" /function="component of mitochondrial electron transport chain" /note="putative cds with undefined initiation codon; 5' and 3' ends based on homology to Plasmodium yoelii coxIII and Plasmodium yoelii mRNA mapping studies" /codon_start=1 /transl_table=4 /product="cytochrome c oxidase subunit III" /protein_id="AAD05207.1" /db_xref="GI:3088636" /translation="FIFSNYNNIKAHLVSYPSLTSLYGTSLKYFSVGILFTFNPIIFI IFVYSIRESFYSIFSSLVSGMLSIIISEAILFITYFWGILHFSLSPYPLYNEGIILTS SRMLILTITFILASASCMTACLQFLIEKGMSLEISSIVFIIYLLGECFASLQTTEYLH LGYCINDAISGTLFYCVTGLHFSHVIVGLLLLLIYFIRIVEMYDTNSEWSYSLYGISY IVLPHTDQITILYWHFVEIVWLFIEFFFYSE" misc_feature 2782..2891 /note="similar to prokaryotic large subunit ribosomal RNA; LS8" misc_feature 2922..2949 /note="similar to prokaryotic small subunit ribosomal RNA; SS5" misc_feature complement(3192..3301) /note="similar to prokaryotic small subunit ribosomal RNA; SS1" gene <3328..4761 /gene="coxI" CDS <3328..4761 /gene="coxI" /function="component of mitochondrial electron transport chain" /note="putative cds with undefined initiation codon; 5' and 3' ends based on homology to Plasmodium yoelii coxI and Plasmodium yoelii mRNA mapping studies" /codon_start=1 /transl_table=4 /product="cytochrome c oxidase subunit I" /protein_id="AAD05205.1" /db_xref="GI:3088634" /translation="FFVFNRYTLITNCNHKTLGLYYLWFSFLFGSYGFLLSVILRTEL YSSSLRIIAQENVNLYNMIFTLHGIIMIFFNIMPGLFGGFGNYFLPILCGSPELAYPR INSISLLLQPIAFILVILSTAAEFGGGTGWTLYPPLSTSLMSLSPVAVDVIIVGLLVS GIASIMSSLNFITTVMHLRSKGLTLGILSVSTWSLIITSVMLLLTLPVLTGGVLMLLS DLHFNTLFFDPTFAGDPILYQHLFWFFGHPEVYILILPAFGVISHVISTNYCRSLFGN QSMILAMSCIAILGSVVWAHHMYTTGLEVDTRAFFTSTTILISIPTGTKIFNWICTYM GSNFGITHSSSLLSLLFICTFTFGGTTGVILGNAAIDIALHDTYYVIAHFHFVLSIGA IIGLFTLVSSFQENFFGKHLRENSIIILWSILFFIGVVLTFLPMHFLGFNVMPRRIPD YPDALNGWNMICSIGSTMTLFGLFIFK" gene 4783..5931 /gene="cytb" CDS 4783..5931 /gene="cytb" /function="component of mitochondrial electron transport chain" /note="putative cds based on homology to Plasmodium yoelii cytb" /codon_start=1 /transl_table=4 /product="apocytochrome b" /protein_id="AAD05206.1" /db_xref="GI:3088635" /translation="MNYYSINLAKAHLLNYPCPLNINFLWNYGFLLGIIFFIQILTGV FLASRYTPEISYAYYSIQHILRELWSGWCFRYMHATGASLVFLLTYLHILRGLNYSYL YLPLSWISGLIIFALFIVTAFIGYVLPWGQMSYWGATVITNLLSSIPVLVIWLCGGYT VSDPTIKRFFVLH