BLASTP 2.0.10 [Aug-26-1999]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= a q (208 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 444,417 sequences; 136,724,657 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs

Distribution of 41 Blast Hits on the Query Sequence



                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAD35262.1|AE001702_2  (AE001702) conserved hypothetical ...   407  e-113
emb|CAB45354.1|  (AL079345) putative DNA-binding protein [St...   170  9e-42
gb|AAD22519.1|AF061257_1  (AF061257) AT-rich DNA-binding pro...   153  1e-36
gb|AAF10515.1|AE001946_7  (AE001946) conserved hypothetical ...   150  9e-36
dbj|BAA75386.1|  (AB013375) YdiH [Bacillus halodurans]            139  2e-32
dbj|BAA19721|  (D88802) ydiH [Bacillus subtilis] >gi|2632910...   133  9e-31
gb|AAD36497.1|AE001794_13  (AE001794) conserved hypothetical...    98  8e-20
gb|AAF18948.1|AF155805_2  (AF155805) Cps9E [Streptococcus suis]    50  2e-05
gi|3135688  (AF064070) putative epimerase/dehydratase WbiI [...    43  0.002
gi|2326958  (U56723) LpsB [Rhizobium etli]                         43  0.003
gb|AAD36615.1|AE001801_2  (AE001801) lipopolysaccharide bios...    41  0.010
dbj|BAA85069.1|  (AB028134) ORF9S [Shigella sonnei]                37  0.15
dbj|BAA85014.1|  (AB025970) ORF9P [Plesiomonas shigelloides]       37  0.15
dbj|BAA33644.1|  (AB012957) unknown [Vibrio cholerae]              36  0.33
dbj|BAA30800.1|  (AP000007) 352aa long hypothetical protein ...    35  0.57
pir||S51266  trsG protein - Yersinia enterocolitica >gi|6336...    35  0.57
gi|2983635  (AE000727) carbamoyl-phosphate synthase large su...    34  0.75
sp|O05252|YUFN_BACSU  HYPOTHETICAL LIPOPROTEIN YUFN PRECURSO...    34  0.75
gi|3033365  (U47057) putative epimerase/dehydratase [Vibrio ...    34  0.98
gi|2649664  (AE001039) conserved hypothetical protein [Archa...    34  0.98
prf||2209416K  ORF 10 [Vibrio cholerae]                            34  0.98
emb|CAB38868.1|  (AJ007638) phosphofructokinase alpha-subuni...    34  1.3
gi|3322336  (AE001192) capsular polysaccharide biosynthesis ...    34  1.3
gi|2649053  (AE000998) conserved hypothetical protein [Archa...    33  2.2
sp|P09975|YCF2_MARPO  HYPOTHETICAL 259 KD PROTEIN (ORF 2136)...    33  2.2
dbj|BAA30354|  (AP000005) 534aa long hypothetical nodulation...    32  2.9
gi|1685053  (U77302) AF/R2 fimbrial major subunit Afr2G [Esc...    32  2.9
sp|Q58484|AROE_METJA  SHIKIMATE 5-DEHYDROGENASE >gi|2129280|...    32  3.8
sp|P80053|DHE3_SULSO  GLUTAMATE DEHYDROGENASE (GDH) >gi|4785...    32  3.8
dbj|BAA18854|  (D90917) hypothetical protein [Synechocystis ...    32  4.9
gb|AAF22846.1|AF210152_3  (AF210152) BaiCD [Clostridium sp. ...    31  6.5
emb|CAA07661.1|  (AJ007747) putative nucleotide sugar epimer...    31  6.5
emb|CAA73377|  (Y12877) ribonucleotide reductase [Thermotoga...    31  6.5
gb|AAC96666.1|  (U42580) A298L [Paramecium bursaria Chlorell...    31  6.5
pir||S70683  bplL protein - Bordetella pertussis >gi|992982|...    31  6.5
sp|Q07083|RPSC_MYXXA  RNA POLYMERASE SIGMA-C FACTOR >gi|5386...    31  6.5
emb|CAB49276.1|  (AJ248284) SUCCINYL-COA SYNTHETASE ALPHA CH...    31  8.5
gi|2649402  (AE001022) conserved hypothetical protein [Archa...    31  8.5
dbj|BAA09716|  (D63413) sarcosine oxidase [Arthrobacter sp.]...    31  8.5
sp|P22988|LDHA_HORVU  L-LACTATE DEHYDROGENASE A (LDH-A) >gi|...    31  8.5
sp|P20286|G3P_PYRWO  GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENAS...    31  8.5

 gb|AAD35262.1|AE001702_2 (AE001702) conserved hypothetical protein [Thermotoga maritima]
           Length = 208
           
 Score =  407 bits (1035), Expect = e-113
 Identities = 208/208 (100%), Positives = 208/208 (100%)

Query: 1   MAEKIPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYFGEFGKR 60
           MAEKIPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYFGEFGKR
Sbjct: 1   MAEKIPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYFGEFGKR 60

Query: 61  GVGYNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSK 120
           GVGYNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSK
Sbjct: 61  GVGYNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSK 120

Query: 121 IGKEAAPGLTVSDVSELEKFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGILNFAPVK 180
           IGKEAAPGLTVSDVSELEKFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGILNFAPVK
Sbjct: 121 IGKEAAPGLTVSDVSELEKFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGILNFAPVK 180

Query: 181 IKVSVPVENIDITASLRVLTFEIVRRNS 208
           IKVSVPVENIDITASLRVLTFEIVRRNS
Sbjct: 181 IKVSVPVENIDITASLRVLTFEIVRRNS 208
 emb|CAB45354.1| (AL079345) putative DNA-binding protein [Streptomyces coelicolor
           A3(2)]
           Length = 258
           
 Score =  170 bits (426), Expect = 9e-42
 Identities = 88/204 (43%), Positives = 124/204 (60%), Gaps = 3/204 (1%)

Query: 5   IPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYFGEFGKRGVGY 64
           IP+    RL  Y   L  L +  V  VSSEELA    + ++++RKD SY G +G RGVGY
Sbjct: 16  IPEATVARLPLYLRALTALSERSVPTVSSEELAAAAGVNSAKLRKDFSYLGSYGTRGVGY 75

Query: 65  NVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKE 124
           +VE+L   I   LG+ ++W +V+VG GN+G A+ANY     +GFR+  + D+DP   GK 
Sbjct: 76  DVEYLVYQISRELGLTQDWPVVIVGIGNLGAALANYGGFASRGFRVAALIDADPGMAGKP 135

Query: 125 AAPGLTVSDVSELEKFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGILNFAPVKIKV- 183
            A G+ V    ELEK +++ GV IGVIA PA  AQ++ +RL  AG+  ILNFAP  + V 
Sbjct: 136 VA-GIPVQHTDELEKIIQDDGVSIGVIATPAGAAQQVCDRLVAAGVTSILNFAPTVLNVP 194

Query: 184 -SVPVENIDITASLRVLTFEIVRR 206
             V V  +D++  L++L F   R+
Sbjct: 195 EGVDVRKVDLSIELQILAFHEQRK 218
 gb|AAD22519.1|AF061257_1 (AF061257) AT-rich DNA-binding protein p25 [Thermus aquaticus]
           Length = 211
           
 Score =  153 bits (383), Expect = 1e-36
 Identities = 89/203 (43%), Positives = 122/203 (59%), Gaps = 5/203 (2%)

Query: 4   KIPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYFGEFGKRGVG 63
           K+P+    RL++Y   LE L  +GV   SSE+L     + A Q+RKDLSYFG +G RGVG
Sbjct: 2   KVPEAAISRLITYLRILEELEAQGVHRTSSEQLGELAQVTAFQVRKDLSYFGSYGTRGVG 61

Query: 64  YNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGK 123
           Y V  L   +  ILG+ ++W L +VG G +G A+A+Y    E  F + G FD DP K+G+
Sbjct: 62  YTVPVLKRELRHILGLNRKWGLCIVGMGRLGSALADYPGFGE-SFELRGFFDVDPEKVGR 120

Query: 124 EAAPGLTVSDVSELEKFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGILNFAPVKIKV 183
               G+ +  V  L + V    +EI ++ VP E AQ+ A+ L  AGIKGILNFAPV ++V
Sbjct: 121 PVRGGV-IEHVDLLPQRVPGR-IEIALLTVPREAAQKAADLLVAAGIKGILNFAPVVLEV 178

Query: 184 --SVPVENIDITASLRVLTFEIV 204
              V VEN+D  A L  L+F I+
Sbjct: 179 PKEVAVENVDFLAGLTRLSFAIL 201
 gb|AAF10515.1|AE001946_7 (AE001946) conserved hypothetical protein [Deinococcus radiodurans]
           Length = 234
           
 Score =  150 bits (375), Expect = 9e-36
 Identities = 87/217 (40%), Positives = 121/217 (55%), Gaps = 21/217 (9%)

Query: 5   IPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYFGEFGKRGVGY 64
           IP     R+V+Y   LE L  + V   SS ELARR  +   Q+RKDL+YFG FG RG+GY
Sbjct: 7   IPTATVGRVVTYIRVLEELEAQNVLRASSGELARRAGVTPFQVRKDLTYFGRFGTRGIGY 66

Query: 65  NVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKE 124
            V  L   +   LG+ + W +V+VG G +G A+ANY    +  F+ +G+FD  P  +G+E
Sbjct: 67  TVAVLRRELLRALGLDQTWNVVIVGMGRLGHAIANYPGASDYQFQNVGLFDVAPDVVGRE 126

Query: 125 AAPGLTVSDVSELEKFVEE-----HGVEIGVIAVPAEHAQEIAERLEKAGIKGILNFAPV 179
              GLT+  +S+L  FV         V++G++ VPAEHAQ  A+ L  AG+ GILNFAPV
Sbjct: 127 VR-GLTIQHMSQLGPFVASVAGTPRQVDMGLLTVPAEHAQAAAQALVAAGVGGILNFAPV 185

Query: 180 KIKV---------------SVPVENIDITASLRVLTF 201
            ++                 V VEN+D  A ++ L F
Sbjct: 186 VLQTQDLHLPEAFAAPGRREVTVENVDFLAGMKRLAF 222
 dbj|BAA75386.1| (AB013375) YdiH [Bacillus halodurans]
           Length = 211
           
 Score =  139 bits (347), Expect = 2e-32
 Identities = 78/200 (39%), Positives = 117/200 (58%), Gaps = 4/200 (2%)

Query: 4   KIPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYFGEFGKRGVG 63
           KIP+  +KRL  YY  LE L   G + VSS EL+  + + ++ IR+D SYFG  GK+G G
Sbjct: 7   KIPQATAKRLPLYYRFLENLHASGKQRVSSSELSEAVKVDSATIRRDFSYFGALGKKGYG 66

Query: 64  YNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGK 123
           YNV +L     + L   +  K++++G GN+G A+ NY   K    +I+  FD D  KIG 
Sbjct: 67  YNVNYLLTFFRKTLHQDELTKVMLIGVGNLGTALLNYNFSKNNHTQIVMAFDVDREKIGN 126

Query: 124 EAAPGLTVSDVSELEKFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGILNFAPVKIKV 183
             + G+ + ++  LE  +    V + ++ VPA  AQ+ A+RL  AG+KGILNF P +I V
Sbjct: 127 TVS-GVKIENLDNLENKITS-DVSVAILTVPAAVAQKTADRLVNAGVKGILNFTPARIAV 184

Query: 184 --SVPVENIDITASLRVLTF 201
              V V +ID++  L+ L +
Sbjct: 185 PEHVRVHHIDLSVELQALIY 204
 dbj|BAA19721| (D88802) ydiH [Bacillus subtilis] >gi|2632910|emb|CAB12416|
           (Z99107) ydiH [Bacillus subtilis]
           Length = 215
           
 Score =  133 bits (332), Expect = 9e-31
 Identities = 75/200 (37%), Positives = 116/200 (57%), Gaps = 5/200 (2%)

Query: 4   KIPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYFGEFGKRGVG 63
           KIP+  +KRL  YY  L+ L   G + VSS EL+  + + ++ IR+D SYFG  GK+G G
Sbjct: 7   KIPQATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGKKGYG 66

Query: 64  YNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGK 123
           YNV++L     + L   +   ++++G GN+G A  +Y   K    +I   FD + SKIG 
Sbjct: 67  YNVDYLLSFFRKTLDQDEMTDVILIGVGNLGTAFLHYNFTKNNNTKISMAFDINESKIGT 126

Query: 124 EAAPGLTVSDVSELEKFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGILNFAPVKIKV 183
           E   G+ V ++ +LE+ V++  V   ++ VPA  AQ I +RL   GIKGILNF P ++ V
Sbjct: 127 EVG-GVPVYNLDDLEQHVKDESV--AILTVPAVAAQSITDRLVALGIKGILNFTPARLNV 183

Query: 184 --SVPVENIDITASLRVLTF 201
              + + +ID+   L+ L +
Sbjct: 184 PEHIRIHHIDLAVELQSLVY 203
 gb|AAD36497.1|AE001794_13 (AE001794) conserved hypothetical protein [Thermotoga maritima]
           Length = 204
           
 Score = 97.5 bits (239), Expect = 8e-20
 Identities = 65/200 (32%), Positives = 102/200 (50%), Gaps = 9/200 (4%)

Query: 1   MAEKI--PKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYFGEFG 58
           MAE I  P+   +RL  Y   LE         +SS+E+AR L++    +RKD SY    G
Sbjct: 1   MAEMIHLPRSTFERLKMYRKVLEATKKP---YISSDEIARFLEINPDLVRKDFSYLNCQG 57

Query: 59  KRGVGYNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDP 118
           K  VGY+VE L   + ++ GV     +++VGA ++ RA+ +    K  G +++ +FD++ 
Sbjct: 58  KPRVGYDVEELRKELDDLFGVNNTTNMIIVGANDLARALLSLDFSKA-GVKVVAVFDTER 116

Query: 119 SKIGKEAAPGLTVSDVSELEKFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGILNFAP 178
             +GK       V ++  LE+ +     EI  + V  + AQ  AE L + GIK + NF  
Sbjct: 117 ENVGKFIGE-FAVRELDVLERVIRRFDAEIAALCVSKDRAQATAEFLIEKGIKAVWNFTG 175

Query: 179 VKIKV--SVPVENIDITASL 196
           V + +   V V   D+T SL
Sbjct: 176 VHLDLPEGVIVVEEDLTQSL 195
 gb|AAF18948.1|AF155805_2 (AF155805) Cps9E [Streptococcus suis]
           Length = 608
           
 Score = 50.0 bits (117), Expect = 2e-05
 Identities = 26/90 (28%), Positives = 49/90 (53%)

Query: 84  KLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFVEE 143
           +++VVGAG+ G    N    ++  F I+GI D DP+K+G        + + +++ + VEE
Sbjct: 150 RILVVGAGDGGNIFINTVKDRKLNFEIVGIVDRDPNKLGTFIRTAKVLGNRNDIPRLVEE 209

Query: 144 HGVEIGVIAVPAEHAQEIAERLEKAGIKGI 173
             V+   IA+P+ + +E  + +E     G+
Sbjct: 210 LAVDQVTIAIPSLNGKEREKIVEICNTTGV 239
 gi|3135688 (AF064070) putative epimerase/dehydratase WbiI [Burkholderia
           pseudomallei]
           Length = 637
           
 Score = 43.0 bits (99), Expect = 0.002
 Identities = 26/104 (25%), Positives = 54/104 (51%), Gaps = 6/104 (5%)

Query: 74  GEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSD 133
           G ++G  K   ++++GAG+ G + A   + +   +R+ G+ D DP+K G+E      +  
Sbjct: 141 GGLIGQGKP--VLILGAGSAGASFAR-ELSRSGEWRLAGLLDDDPAKHGREVYGYKVLGS 197

Query: 134 VSELEKFVEEHGVEIGVIAVPA---EHAQEIAERLEKAGIKGIL 174
           + E+  + E    E  +IA+P+   E  +  A    +AG++ ++
Sbjct: 198 IGEVADWAEAAKAEYAIIAIPSASVEAQRRFATLCVRAGVRAMV 241
 gi|2326958 (U56723) LpsB [Rhizobium etli]
           Length = 683
           
 Score = 42.6 bits (98), Expect = 0.003
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 5/105 (4%)

Query: 69  LYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPG 128
           L D    IL      K+++ GAGN GR +A   +       ++G  D DP ++      G
Sbjct: 154 LGDTYQRILHQNTLAKVLIYGAGNAGRQLAG-ALTNSAELNVVGYLDDDP-RLKGGIMGG 211

Query: 129 LTVSDVSELEKFVEEHGVEIGVIAVPAEHAQ---EIAERLEKAGI 170
           L + D S+L    E  GV   ++A+P+   Q   EI E + KA +
Sbjct: 212 LPIYDPSDLPVLAETLGVHNVLLALPSASRQRRNEILEHIRKARV 256
 gb|AAD36615.1|AE001801_2 (AE001801) lipopolysaccharide biosynthesis protein [Thermotoga
           maritima]
           Length = 605
           
 Score = 40.6 bits (93), Expect = 0.010
 Identities = 23/95 (24%), Positives = 46/95 (48%)

Query: 79  VKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELE 138
           V  E +++++GAG+ G ++           +I+   D  P KIG++         + +  
Sbjct: 130 VPGEKRILIIGAGDAGVSILEEFEKHPHLGKIVAFVDDSPRKIGRKVRGVPVFGPIEKTM 189

Query: 139 KFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGI 173
           +FVE+  V+  VIA+P+    E+   L+   +K +
Sbjct: 190 EFVEKMNVDEIVIAIPSASRAEMERILKSIDLKKV 224
 dbj|BAA85069.1| (AB028134) ORF9S [Shigella sonnei]
           Length = 639
           
 Score = 36.7 bits (83), Expect = 0.15
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 5/92 (5%)

Query: 78  GVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSEL 137
           GVK    +++ GAG  GR +    +M+ K +  +   D +P ++ K    G+TV    +L
Sbjct: 136 GVKGSAPVLIYGAGESGRQLLP-ALMQAKEYFPVAFVDDNP-RLHKAVIHGVTVYPSDKL 193

Query: 138 EKFVEEHGVEIGVIAVPA---EHAQEIAERLE 166
              V+ +G++  ++A+P+      Q++  RLE
Sbjct: 194 SYLVDRYGIKKILLAMPSVSKSQRQKVITRLE 225
 dbj|BAA85014.1| (AB025970) ORF9P [Plesiomonas shigelloides]
           Length = 639
           
 Score = 36.7 bits (83), Expect = 0.15
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 5/92 (5%)

Query: 78  GVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSEL 137
           GVK    +++ GAG  GR +    +M+ K +  +   D +P ++ K    G+TV    +L
Sbjct: 136 GVKGSAPVLIYGAGESGRQLLP-ALMQAKEYFPVAFVDDNP-RLHKAVIHGVTVYPSDKL 193

Query: 138 EKFVEEHGVEIGVIAVPA---EHAQEIAERLE 166
              V+ +G++  ++A+P+      Q++  RLE
Sbjct: 194 SYLVDRYGIKKILLAMPSVSKSQRQKVITRLE 225
 dbj|BAA33644.1| (AB012957) unknown [Vibrio cholerae]
           Length = 646
           
 Score = 35.6 bits (80), Expect = 0.33
 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 85  LVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFVEEH 144
           +++ GAG+ GR +A   +   + ++++G  D D + +      GL V D+S     V+++
Sbjct: 146 VLIYGAGSAGRQLA-IALRNSENYKVVGFIDQDKT-LENTVIMGLQVYDISRAAYLVDKY 203

Query: 145 GVEIGVIAVPA 155
            V   ++AVP+
Sbjct: 204 DVTQVLLAVPS 214
 dbj|BAA30800.1| (AP000007) 352aa long hypothetical protein [Pyrococcus horikoshii]
           Length = 352
           
 Score = 34.8 bits (78), Expect = 0.57
 Identities = 32/111 (28%), Positives = 54/111 (47%), Gaps = 21/111 (18%)

Query: 84  KLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFVE- 142
           K++++GAGNIGRA+A    +K++    IG  +++  +  KE A  L V D S  +K VE 
Sbjct: 5   KVLILGAGNIGRAIA--WDLKDEFDVYIGDVNNENLEKVKEFATPLKV-DASNFDKLVEV 61

Query: 143 EHGVEIGVIAVPAEHAQEIAERLEKAGIKGILNFAPVKIKVSVPVENIDIT 193
               E+ + A+P                 G L F  +K  +   V+ +D++
Sbjct: 62  MKEFELVIGALP-----------------GFLGFKSIKAAIKSKVDMVDVS 95
 pir||S51266 trsG protein - Yersinia enterocolitica >gi|633698|emb|CAA87704|
           (Z47767) WbcP [Yersinia enterocolitica]
           Length = 638
           
 Score = 34.8 bits (78), Expect = 0.57
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 78  GVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSEL 137
           GV+ +  +V+ GAG  GR +    +   + F I   F  D  K+ K    G+TV    +L
Sbjct: 137 GVRGQIPVVIYGAGASGRQLLPALMQASEYFPIA--FVDDNPKLHKAVIHGVTVYPSEKL 194

Query: 138 EKFVEEHGVEIGVIAVPA 155
           E  +  +G++  ++A+P+
Sbjct: 195 EYLIGRYGIKKVLLAMPS 212
 gi|2983635 (AE000727) carbamoyl-phosphate synthase large subunit [Aquifex
           aeolicus]
           Length = 537
           
 Score = 34.4 bits (77), Expect = 0.75
 Identities = 29/106 (27%), Positives = 47/106 (43%), Gaps = 9/106 (8%)

Query: 74  GEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAP----GL 129
           GE++G+ KE+ L    A    +  A Y  + EKG   I + D D  KI + A      G 
Sbjct: 374 GEVMGIDKEFGLAYYKA----QLSAGYR-LPEKGNLFISVADRDKPKILELAKEFEKLGF 428

Query: 130 TVSDVSELEKFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGILN 175
            +   S   KF++EHGV    +   +E    + + +    I  ++N
Sbjct: 429 GIYATSGTYKFLKEHGVNAKRVLKVSEGRPNVVDMIINGEIHLVIN 474
 sp|O05252|YUFN_BACSU HYPOTHETICAL LIPOPROTEIN YUFN PRECURSOR >gi|1934811|emb|CAB07936|
           (Z93937) unknown [Bacillus subtilis]
           >gi|2635650|emb|CAB15143| (Z99120) similar to ABC
           transporter (lipoprotein) [Bacillus subtilis]
           Length = 350
           
 Score = 34.4 bits (77), Expect = 0.75
 Identities = 31/101 (30%), Positives = 50/101 (48%), Gaps = 7/101 (6%)

Query: 61  GVGYNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSK 120
           GVGY +E   D+I EI   +K     ++ A      VA+ T  +++G  ++G+  +  SK
Sbjct: 98  GVGYLME---DSISEIADQRKNTNFAIIDAVVDKDNVASITFKEQEGSFLVGVAAALSSK 154

Query: 121 IGKEAAPGLTVSDVSELEKFVEEHGVEIGVIAVPAEHAQEI 161
            GK    G   S++  ++KF  E G   GV AV  +   E+
Sbjct: 155 SGKIGFVGGMESEL--IKKF--EVGFRAGVQAVNPKAVVEV 191
 gi|3033365 (U47057) putative epimerase/dehydratase [Vibrio cholerae O139]
           >gi|3724325|dbj|BAA33614.1| (AB012956) unknown [Vibrio
           cholerae]
           Length = 646
           
 Score = 34.0 bits (76), Expect = 0.98
 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 85  LVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFVEEH 144
           +++ GAG+ GR +A   +   + +++ G  D+D + +      G+ V DVS     V+++
Sbjct: 146 VLIYGAGSAGRQLA-IALRNSENYKVAGFIDNDKT-LENTVIMGMQVHDVSRAAYLVDKY 203

Query: 145 GVEIGVIAVPA 155
            V   ++AVP+
Sbjct: 204 DVTQILLAVPS 214
 gi|2649664 (AE001039) conserved hypothetical protein [Archaeoglobus fulgidus]
           Length = 666
           
 Score = 34.0 bits (76), Expect = 0.98
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 13/105 (12%)

Query: 73  IGEILGVKKEWKLVVVGAGNIGRAVANYTV---MKEKGFRIIGIFDSDPSKIGKEAAPGL 129
           +G+I    K   + V+GA      V N  V   M  K  RI  I  +    +G +A P  
Sbjct: 216 VGDISFFFKARSVAVIGASTNPIKVGNSVVRSLMSNKNLRIYPINPNASEILGLKAYP-- 273

Query: 130 TVSDVSELEKFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGIL 174
           +V  + E+         +I ++ VPAE   +      +AG+KG++
Sbjct: 274 SVKSLPEVP--------DIAIVTVPAEFVLDAVREAAEAGVKGVV 310
 prf||2209416K ORF 10 [Vibrio cholerae]
           Length = 227
           
 Score = 34.0 bits (76), Expect = 0.98
 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 85  LVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFVEEH 144
           +++ GAG+ GR +A   +   + +++ G  D+D + +      G+ V DVS     V+++
Sbjct: 146 VLIYGAGSAGRQLA-IALRNSENYKVAGFIDNDKT-LENTVIMGMQVHDVSRAAYLVDKY 203

Query: 145 GVEIGVIAVPA 155
            V   ++AVP+
Sbjct: 204 DVTQILLAVPS 214
 emb|CAB38868.1| (AJ007638) phosphofructokinase alpha-subunit [Candida albicans]
           Length = 987
           
 Score = 33.6 bits (75), Expect = 1.3
 Identities = 38/154 (24%), Positives = 70/154 (44%), Gaps = 24/154 (15%)

Query: 29  EVVSSEELARRLDLKASQIRKDLSYFGEFGKRGVGYNVEHLYDAIGEILGVKKEWKLVVV 88
           E +S+++  + + L+ +    D  YF +            +YD   + L   K   + +V
Sbjct: 572 EAISNKDFDKAMSLRDNSFYDDYRYFRDIS----------IYDDGSKQLSEDKRLNIAIV 621

Query: 89  --GAGNIG-----RAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFV 141
             GA + G     RAVA Y++   +G ++  + D     + K     LT  DV   E + 
Sbjct: 622 HVGAASAGLNAATRAVALYSL--SRGHKLYAVQDGFAGLV-KGDLKNLTWMDV---EGWH 675

Query: 142 EEHGVEIGVI-AVPAEHAQEIAERLEKAGIKGIL 174
              G EIG   ++P+++  ++A  L+K  I+G+L
Sbjct: 676 SLGGSEIGTNRSLPSQNIGKVAYNLQKFNIQGLL 709
 gi|3322336 (AE001192) capsular polysaccharide biosynthesis protein (cap5D)
           [Treponema pallidum]
           Length = 538
           
 Score = 33.6 bits (75), Expect = 1.3
 Identities = 35/122 (28%), Positives = 55/122 (44%), Gaps = 11/122 (9%)

Query: 85  LVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFVEEH 144
           + +VGAG  G  +A     K+    +I   D DP KIG        +  + E+ + V   
Sbjct: 48  IYIVGAGFAGSVLAREIQTKKVLGTVIAFLDDDPCKIGSNLHGVPVLGPIFEVARIVRIT 107

Query: 145 GVEIGVIAVPA---EHAQEIAERLEKAGIKGILNFAPVKIKVSVPVENIDITASLRVLTF 201
             +  +IA+P+   E  ++I   L  AG      F  +K+  ++  + ID TA L V T 
Sbjct: 108 PHDHALIAIPSISIERLRDIYLTLRAAG------FTVIKLLPAL-AQIIDGTAHL-VQTR 159

Query: 202 EI 203
           EI
Sbjct: 160 EI 161
 gi|2649053 (AE000998) conserved hypothetical protein [Archaeoglobus fulgidus]
           Length = 881
           
 Score = 32.8 bits (73), Expect = 2.2
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 14/94 (14%)

Query: 85  LVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGL----TVSDVSELEKF 140
           + V+GA      V   T      +R  G+  + P     +A  G+    T+S+V +    
Sbjct: 200 VAVIGASRDVEKVGGRTFYNLLTYRFNGV--AYPVNRAAKAIMGVRAYPTISEVPD---- 253

Query: 141 VEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGIL 174
                VE+ V++VP ++A E+AE   K G+K +L
Sbjct: 254 ----EVELAVLSVPVKYALEVAEECGKKGVKALL 283
 sp|P09975|YCF2_MARPO HYPOTHETICAL 259 KD PROTEIN (ORF 2136) >gi|81341|pir||A05037
            hypothetical protein 2136 - liverwort (Marchantia
            polymorpha) chloroplast >gi|11665|emb|CAA28078| (X04465)
            ORF2136 [Marchantia polymorpha]
            Length = 2136
            
 Score = 32.8 bits (73), Expect = 2.2
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 5    IPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKAS--QIRKDLSYFGEFGKRGV 62
            +PK V   L+S    L+++++  +  +S  +    L LK    Q++++L +  EFG R +
Sbjct: 1523 LPKKVDPALISPNR-LDKIINVRLFNISQRKKQFPLLLKKKNFQLKENLFFLNEFGSRTM 1581

Query: 63   GYNVEHLYDAIGEIL 77
            GYN+  L     E+L
Sbjct: 1582 GYNLRDLSALTNEVL 1596
 dbj|BAA30354| (AP000005) 534aa long hypothetical nodulation protein [Pyrococcus
           horikoshii]
           Length = 534
           
 Score = 32.5 bits (72), Expect = 2.9
 Identities = 29/111 (26%), Positives = 49/111 (44%), Gaps = 9/111 (8%)

Query: 65  NVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRII-----GIFDSDPS 119
           N  +   AI E+ G+  E KL V+G     +    +    EK   +      GI D++  
Sbjct: 180 NPRYELSAIIELNGLTFENKLKVIGTEATKKLAEFFEFPLEKAKEVSSNLKRGIMDNELE 239

Query: 120 KIGKEAAPGLTVSDVSELEKFVEEHGVEIGVIAVPAEHAQEIAERLEKAGI 170
           K   E A     S  + LE+ +EE G+E+    +P  +A  +A+ ++   I
Sbjct: 240 KKAIEIA----ASAQAHLERLIEEMGLELKKYELPIAYAGGVAQNVKANAI 286
 gi|1685053 (U77302) AF/R2 fimbrial major subunit Afr2G [Escherichia coli]
           Length = 279
           
 Score = 32.5 bits (72), Expect = 2.9
 Identities = 23/72 (31%), Positives = 35/72 (47%), Gaps = 3/72 (4%)

Query: 63  GYNVEHLYDAIGEILGVKKEWKLVVVGAGNIGR--AVANYTVMKEKGFRIIGIFDSDPSK 120
           G+ V  + +   E  G  K W   V  AG+ G   A+ NY++   +G  +   FDS  + 
Sbjct: 205 GWTVTEMMNKWNEFTGQNKSWIQTVYSAGSSGTIDALYNYSLSIAQGQTLEAEFDSPVTT 264

Query: 121 IGKEAAPGLTVS 132
             K +AP LT+S
Sbjct: 265 TTKWSAP-LTIS 275
 sp|Q58484|AROE_METJA SHIKIMATE 5-DEHYDROGENASE >gi|2129280|pir||C64435 shikimate
           5-dehydrogenase (EC 1.1.1.25) - Methanococcus jannaschii
           >gi|1591730 (U67551) shikimate 5-dehydrogenase (aroE)
           [Methanococcus jannaschii]
           Length = 282
           
 Score = 32.1 bits (71), Expect = 3.8
 Identities = 40/133 (30%), Positives = 58/133 (43%), Gaps = 20/133 (15%)

Query: 35  ELARRLDLKASQIRKDLSYFG-------EFGKRGVGYNVEHLYD--AIGEILGVKKEWKL 85
           E+ + LD    +I KD    G       E GK  +GYN + +    A+ E +G  K+  +
Sbjct: 72  EIMKYLD----EIDKDAQLIGAVNTIKIEDGK-AIGYNTDGIGARMALEEEIGRVKDKNI 126

Query: 86  VVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKF----V 141
           V+ GAG   RAVA + + K+    I          + KE A  L      E  KF    V
Sbjct: 127 VIYGAGGAARAVA-FELAKDNNIIIANRTVEKAEALAKEIAEKLN-KKFGEEVKFSGLDV 184

Query: 142 EEHGVEIGVIAVP 154
           +  GV+I + A P
Sbjct: 185 DLDGVDIIINATP 197
 sp|P80053|DHE3_SULSO GLUTAMATE DEHYDROGENASE (GDH) >gi|478591|pir||S20286 glutamate
           dehydrogenase - Sulfolobus solfataricus
           >gi|243120|bbs|76301 glutamate dehydrogenase, GDH
           [Sulfolobus solfataricus, strain MT-4, Peptide, 421 aa]
           >gi|228559|prf||1806206A Glu dehydrogenase [Sulfolobus
           solfataricus]
           Length = 421
           
 Score = 32.1 bits (71), Expect = 3.8
 Identities = 19/79 (24%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 61  GVGYNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSK 120
           G+G       +A  + +G  +E ++++ G GN+G     +  + E G +I+G+ DS    
Sbjct: 193 GLGVATIAKEEAANKFIGGVEEARVIIQGFGNVGYYAGKF--LSEMGAKIVGVSDSKGGV 250

Query: 121 IGKEAAPGLTVSDVSELEK 139
           I ++   G+ V    E+++
Sbjct: 251 INEK---GIDVGKAIEIKE 266
 dbj|BAA18854| (D90917) hypothetical protein [Synechocystis sp.]
           Length = 470
           
 Score = 31.7 bits (70), Expect = 4.9
 Identities = 34/119 (28%), Positives = 50/119 (41%), Gaps = 16/119 (13%)

Query: 84  KLVVVGAGN--------IGRAVANYTVMKEKGFRIIGIFDS--DPSKIGKEAAPGLTVSD 133
           ++V++GA          + R    Y VM     +I+GI D    PS  G+    G+ + +
Sbjct: 25  RVVILGAAGRDFHNFNQVYRDNPRYEVMAFTATQIVGIADRRYPPSLAGELYPHGIPILE 84

Query: 134 VSELEKFVEEHGVEIGVIA---VPAEHAQEIAERLEKAGIKGILNFAP--VKIKVSVPV 187
             +LE F  EH V+  V A   V       +A R    G   +L   P    IK +VPV
Sbjct: 85  EGQLENFCREHRVDQIVFAYSDVSHHQVMHLASRSLAIGADFVL-LGPNQTMIKTTVPV 142
 gb|AAF22846.1|AF210152_3 (AF210152) BaiCD [Clostridium sp. TO-931]
           Length = 639
           
 Score = 31.3 bits (69), Expect = 6.5
 Identities = 23/102 (22%), Positives = 50/102 (48%), Gaps = 12/102 (11%)

Query: 19  CLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYFGEFGKRGVG-------YNVEHLYD 71
           C++ L+DE   V++ EE+   ++ + + +  D++       +          +N++H ++
Sbjct: 211 CIDELMDE---VMTEEEIVEFIN-RCADLGVDVADLSRGNAQSFATVYEVPPFNLQHGFN 266

Query: 72  AIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGI 113
            I  I  +KK+ K+ V+G G I        V+ +  F ++GI
Sbjct: 267 -IENIYNIKKQIKIPVMGVGRINTGEMANQVIADGKFDLVGI 307
 emb|CAA07661.1| (AJ007747) putative nucleotide sugar epimerase/ dehydratase
           [Bordetella bronchiseptica]
           Length = 624
           
 Score = 31.3 bits (69), Expect = 6.5
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 2/84 (2%)

Query: 85  LVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFVEEH 144
           +++ GAG  G  +A   +     +R + + D D  K  +    GL V    +L K ++ H
Sbjct: 152 VLIYGAGGAGSQLA-MALRAGPHYRPVAMLDDDKRK-HRLVVNGLRVYPPEQLPKLIDRH 209

Query: 145 GVEIGVIAVPAEHAQEIAERLEKA 168
            +   +IA+P+   ++I   +E A
Sbjct: 210 NIRQLLIAMPSAPPKQIRSIVEAA 233
 emb|CAA73377| (Y12877) ribonucleotide reductase [Thermotoga maritima]
           >gi|4980610|gb|AAD35212.1|AE001698_1 (AE001698)
           ribonucleotide reductase, B12-dependent [Thermotoga
           maritima]
           Length = 827
           
 Score = 31.3 bits (69), Expect = 6.5
 Identities = 27/126 (21%), Positives = 57/126 (44%), Gaps = 16/126 (12%)

Query: 71  DAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAP--- 127
           D+I EI    KE+ L+    G +G   +N++ ++ KG  + G         GK + P   
Sbjct: 141 DSIEEIFEAVKEYALITKVGGGVG---SNFSELRPKGSFVAGTH-------GKASGPVSF 190

Query: 128 -GLTVSDVSELEKFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGILNFAPVKIKVSVP 186
             +  S +S +++     G  +G++ +     +E  +  ++   + +LNF    + V  P
Sbjct: 191 MHVFNSAISVVKQGYRRRGALMGILNINHPDIEEFIDAKKENTGEAVLNF--FNLSVGFP 248

Query: 187 VENIDI 192
           ++  +I
Sbjct: 249 MDKKEI 254
 gb|AAC96666.1| (U42580) A298L [Paramecium bursaria Chlorella virus 1]
           Length = 225
           
 Score = 31.3 bits (69), Expect = 6.5
 Identities = 34/142 (23%), Positives = 71/142 (49%), Gaps = 18/142 (12%)

Query: 73  IGEILG----VKKEWKLVVVGAGNIGRAVAN-YTVMKEKGFRIIGI---FD--SDPSKIG 122
           + EILG    +++  + V +GA + G A+ N + +MK     ++ +   FD  +D ++I 
Sbjct: 35  VEEILGRLGCLRRNQRCVEIGAPD-GIAIPNTFNLMKNHEMHVLYLETEFDPETDIAEIE 93

Query: 123 KEAAPGLTVSDVSELEKFVEEHGV--EIGVIAVPAEHAQEIAERLEKAGIKGILNFAPVK 180
           KE    +  ++  ++E  +EEHG+  E  V+++ A   +   +  EK   + ++   P+ 
Sbjct: 94  KEFRITVVKTNSKDVETVIEEHGMPKEFAVMSIDANGLE--YDIFEKTKFEPLIVVVPIN 151

Query: 181 IKVSVPVE---NIDITASLRVL 199
            K+    E   +I + AS + +
Sbjct: 152 PKIRPTEEQTPSIGVRASFKTM 173
 pir||S70683 bplL protein - Bordetella pertussis >gi|992982|emb|CAA62256|
           (X90711) gene referred to as bplL in Mol. Microbiol.
           19:37-52(1996) [Bordetella pertussis]
           >gi|1589232|prf||2210367P bplL gene [Bordetella
           pertussis]
           Length = 624
           
 Score = 31.3 bits (69), Expect = 6.5
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 2/84 (2%)

Query: 85  LVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFVEEH 144
           +++ GAG  G  +A   +     +R + + D D  K  +    GL V    +L K ++ H
Sbjct: 152 VLIYGAGGAGSQLA-MALRTGPHYRPVAMLDDDKRK-HRLVVNGLRVYPPEQLPKLIDRH 209

Query: 145 GVEIGVIAVPAEHAQEIAERLEKA 168
            +   +IA+P+   ++I   +E A
Sbjct: 210 NIRQLLIAMPSAPPKQIRSIVEAA 233
 sp|Q07083|RPSC_MYXXA RNA POLYMERASE SIGMA-C FACTOR >gi|538660|pir||A40587 probable
           transcription initiation factor sigma sigC - Myxococcus
           xanthus >gi|293866 (L12992) sigma factor [Myxococcus
           xanthus]
           Length = 295
           
 Score = 31.3 bits (69), Expect = 6.5
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 8/50 (16%)

Query: 20  LERLLDEGVEVVSSEELARRLDLKASQIR--------KDLSYFGEFGKRG 61
           LE++      VV++EE+AR+L++KAS++R        +DLS     G+ G
Sbjct: 142 LEKMGAGDANVVNAEEIARKLNVKASEVREMEQRMGGRDLSLDAPMGEDG 191
 emb|CAB49276.1| (AJ248284) SUCCINYL-COA SYNTHETASE ALPHA CHAIN related protein
           [Pyrococcus abyssi]
           Length = 472
           
 Score = 30.9 bits (68), Expect = 8.5
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 14/96 (14%)

Query: 85  LVVVGA----GNIGRAV-ANYTVMKEKGFRIIGIFDSDPSKIGKEAAPGLTV-SDVSELE 138
           + ++GA    G +G  +  N+   KEKG     I+  +P     +   G  V  DVSEL 
Sbjct: 19  VAIIGATNKKGKVGNVIFENFKRNKEKGIFKGNIYPVNPKL---DEIDGYKVYHDVSELP 75

Query: 139 KFVEEHGVEIGVIAVPAEHAQEIAERLEKAGIKGIL 174
                   ++ VIA+PA    E  +++ + GIK ++
Sbjct: 76  D-----DTDLAVIAIPAPAVPETMKKIAEKGIKAVI 106
 gi|2649402 (AE001022) conserved hypothetical protein [Archaeoglobus fulgidus]
           Length = 664
           
 Score = 30.9 bits (68), Expect = 8.5
 Identities = 12/29 (41%), Positives = 22/29 (75%)

Query: 146 VEIGVIAVPAEHAQEIAERLEKAGIKGIL 174
           V++ VIAVP+++A E+ +   + G+KGI+
Sbjct: 282 VDLAVIAVPSKNAIEVVKECAEKGVKGII 310
 dbj|BAA09716| (D63413) sarcosine oxidase [Arthrobacter sp.]
           >gi|3116221|dbj|BAA25926| (AB007122) sarcosine oxidase
           [Arthrobacter sp.]
           Length = 389
           
 Score = 30.9 bits (68), Expect = 8.5
 Identities = 13/42 (30%), Positives = 27/42 (63%), Gaps = 2/42 (4%)

Query: 77  LGVKKEWKLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDP 118
           + +KK++ ++VVGAG++G A   Y  + ++G + + +   DP
Sbjct: 1   MSIKKDYDVIVVGAGSMGMAAGYY--LSKQGVKTLLVDSFDP 40
 sp|P22988|LDHA_HORVU L-LACTATE DEHYDROGENASE A (LDH-A) >gi|100588|pir||A36070 L-lactate
           dehydrogenase (EC 1.1.1.27) chain A - barley >gi|167067
           (M55685) L-lactate dehydrogenase [Hordeum vulgare]
           Length = 356
           
 Score = 30.9 bits (68), Expect = 8.5
 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 84  KLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEA 125
           K+ V+GAGN+G A+A  T++ +     I + D+ P K+  EA
Sbjct: 45  KISVIGAGNVGMAIAQ-TILTQNLADEIALVDALPDKLRGEA 85
 sp|P20286|G3P_PYRWO GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE (GAPDH)
           >gi|66030|pir||DEQYG glyceraldehyde-3-phosphate
           dehydrogenase (NAD(P)+) (EC 1.2.1.-) - Pyrococcus woesei
           >gi|151735 (M83988) glyceraldehyde 3-phosphate
           dehydrogenase [Pyrococcus woesei]
           Length = 334
           
 Score = 30.9 bits (68), Expect = 8.5
 Identities = 33/106 (31%), Positives = 48/106 (45%), Gaps = 18/106 (16%)

Query: 84  KLVVVGAGNIGRAVANYTVMKEKGFRIIGIFDSDPSKIGKEAAP-GLTVSDVSE--LEKF 140
           K+ + G G IG+ VA Y V K+    +IG+  + P      A   G+ V   SE  L +F
Sbjct: 4   KVGINGYGTIGKRVA-YAVTKQDDMELIGVTKTKPDFEAYRAKELGIPVYAASEEFLPRF 62

Query: 141 VEEHG-------------VEIGVIAVPAEHAQEIAERLEKAGIKGI 173
            E+ G             V+I V A P    ++  +  EKAG+K I
Sbjct: 63  -EKAGFEVEGTLNDLLEKVDIIVDATPGGMGEKNKQLYEKAGVKAI 107
  Database: Non-redundant GenBank CDS
  translations+PDB+SwissProt+SPupdate+PIR
    Posted date:  Jan 12, 2000  2:26 PM
  Number of letters in database: 136,724,657
  Number of sequences in database:  444,417
  
Lambda     K      H
   0.317    0.138    0.379 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 53618531
Number of Sequences: 444417
Number of extensions: 2197747
Number of successful extensions: 6819
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 27
Number of HSP's that attempted gapping in prelim test: 6789
Number of HSP's gapped (non-prelim): 45
length of query: 208
length of database: 136,724,657
effective HSP length: 56
effective length of query: 152
effective length of database: 111,837,305
effective search space: 16999270360
effective search space used: 16999270360
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.6 bits)
S2: 68 (30.9 bits)