Gertraud Burger | teaching MCB6012

Lecture
    Pertsemlidis A & Fondon III JW 2001. Tutorial "Having a Blast with bioinformatics". Genome Biology 2:reviews2002.1-10 (PDF file)

    Tache: Ecrivez 1/2 page de resumé qui est à remettre lors de la séance respective.

Exercice

    Le but de cette exercice est de faire une hypothèse sur la fonction potentielle d'une protéines inconnue. D'ailleurs, l'organisme auquel cette protéine appartient est inconnu également.

    La fonction potentielle d'une protéine inconnue se laisse déduire de la resemblance de sa séquence avec celle d'une autre dont la fonction est connue.

    Donc, cherchez des protéines qui ressemblent à la séquence "unknown-protein" en utilisant le service web du NCBI (http://www.ncbi.nih.gov/blast),qui offre sous la section protein blast l'argorithme psi-blast. psi-blast vous permet de cribler toutes les séquences inclues dans la grande base de donnée "non redundant (nr)".

    >unknown-protein
    MQYTLIYTPTLAMFIYTTREYIIRPYTQTMYNNETLVTLSYMVFKLSVIEYPKESYVEQSA
    QSRNEIQVERNFAISGRFSTYNKPNNTKTRPNRWVHATEKSTPASVLNYWRTFQAAMET
    VSAKSPNRSTLIEMEARILHAIHLMNINEEFLAFWEITSLI*
    

    Procedure: Parmi les 'hits' de la première recherche psi-BLAST, selectionnez les protéines les plus similiaires à celle de 'unknown-protein', et répétez ainsi la recherche psi-BLAST plusieures fois. On trouvera de cette façon les autres membres de cette famille de protéines. Idéalement, la fonction d'un des membres est connue. Ceci permet d'inférer la fonction de la protéine 'unknown-protein'.


    Question 1: Quelle est, selon vous, la fonction de la protéine "unknown-protein"?
    Question 2: A quel domaine de vie appartient probablement l'organisme possèdant cette protéine?
    Question 3: A quelle protéine bactérienne resemble la protéine inconnue?

Barème

    Résumé 60 %
    Exercice 30 %
    Participation 10 %.
    Remise en retard: -20% par jour.

Back to GB's homepage